PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6BL_7755E4A8A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 114aa    MW: 12992 Da    PI: 9.2816
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6BL_7755E4A8A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-161462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W++eEd +l+ ++ + G+g +W + ++++g++R++k+c++rw++yl
  Traes_6BL_7755E4A8A.1 14 KGPWSPEEDAKLKAYIDENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                           79**********************************************7 PP

2Myb_DNA-binding41.72.7e-1369111246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Traes_6BL_7755E4A8A.1  69 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                            789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.946962IPR017930Myb domain
SuperFamilySSF466891.0E-2612109IPR009057Homeodomain-like
SMARTSM007172.5E-111364IPR001005SANT/Myb domain
PfamPF002493.6E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-241569IPR009057Homeodomain-like
CDDcd001678.85E-81662No hitNo description
PROSITE profilePS5129421.14463114IPR017930Myb domain
SMARTSM007177.1E-667114IPR001005SANT/Myb domain
PfamPF002495.9E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2270114IPR009057Homeodomain-like
CDDcd001677.42E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSPE EDAKLKAYID ENGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEEHIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141147105B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573138.12e-81PREDICTED: transcription factor MYB30-like
SwissprotQ9M2Y94e-76RAX3_ARATH; Transcription factor RAX3
TrEMBLW5GBM18e-83W5GBM1_WHEAT; Uncharacterized protein
TrEMBLW5GV071e-82W5GV07_WHEAT; Uncharacterized protein
STRINGMLOC_58499.14e-82(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-77myb domain protein 84
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]